CDS

Accession Number TCMCG073C22479
gbkey CDS
Protein Id XP_010547597.1
Location join(4289784..4289786,4289929..4290012,4290177..4290195,4290299..4290387,4290467..4290520,4290826..4290978,4291291..4291387,4291511..4291581)
Gene LOC104819292
GeneID 104819292
Organism Tarenaya hassleriana

Protein

Length 189aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA268022
db_source XM_010549295.1
Definition PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase PASTICCINO 2-like isoform X2 [Tarenaya hassleriana]

EGGNOG-MAPPER Annotation

COG_category I
Description Catalyzes the third of the four reactions of the long- chain fatty acids elongation cycle. This endoplasmic reticulum- bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators
KEGG_TC -
KEGG_Module M00415        [VIEW IN KEGG]
KEGG_Reaction R07760        [VIEW IN KEGG]
R10827        [VIEW IN KEGG]
KEGG_rclass RC00770        [VIEW IN KEGG]
RC01095        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01004        [VIEW IN KEGG]
KEGG_ko ko:K10703        [VIEW IN KEGG]
EC 4.2.1.134        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00062        [VIEW IN KEGG]
ko01040        [VIEW IN KEGG]
ko01110        [VIEW IN KEGG]
ko01212        [VIEW IN KEGG]
map00062        [VIEW IN KEGG]
map01040        [VIEW IN KEGG]
map01110        [VIEW IN KEGG]
map01212        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005789        [VIEW IN EMBL-EBI]
GO:0006082        [VIEW IN EMBL-EBI]
GO:0006629        [VIEW IN EMBL-EBI]
GO:0006631        [VIEW IN EMBL-EBI]
GO:0006633        [VIEW IN EMBL-EBI]
GO:0006643        [VIEW IN EMBL-EBI]
GO:0006665        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008610        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016021        [VIEW IN EMBL-EBI]
GO:0016053        [VIEW IN EMBL-EBI]
GO:0016829        [VIEW IN EMBL-EBI]
GO:0016835        [VIEW IN EMBL-EBI]
GO:0016836        [VIEW IN EMBL-EBI]
GO:0018812        [VIEW IN EMBL-EBI]
GO:0019752        [VIEW IN EMBL-EBI]
GO:0030148        [VIEW IN EMBL-EBI]
GO:0030176        [VIEW IN EMBL-EBI]
GO:0030497        [VIEW IN EMBL-EBI]
GO:0031224        [VIEW IN EMBL-EBI]
GO:0031227        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032787        [VIEW IN EMBL-EBI]
GO:0042175        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043436        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044255        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044283        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044432        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046394        [VIEW IN EMBL-EBI]
GO:0046467        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0072330        [VIEW IN EMBL-EBI]
GO:0098827        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACGCTGAAGGAATCGGGACACGAACATGTCTACGAAGCTGTCGAGAAGCCTCTCCAACTTGCTCAGACCGCCGCCGTTCTCGAGATTCTTCATGGATTGGTAGGTTTGGTTAGATCTCCAGTTTCTGCAACGCTGCCACAGATAGGTTCAAGGCTATATGTTACATGGGGCATCCTATACAGTTTTCCCGAGGTTCGATCTCATTTCCTTGTTACCTCGTTGGTCATCAGTTGGTCCATCACCGAGACTATACGGTACTCATTCTTCGGCCTCAAAGAAGGTTTGGGCTCTGCTCCTTCATGGCTCCTATGGCTCAGGTACAGCAGCTTTCTGTTGTTATATCCAACCGGTATCACCAGCGAAGTCGGTCTTATCTACCTCGCCTTGCCACATATTAAGGAGACAGAGAAGTATTGCATTAGGATGCCGAACAAATGGAACTTCTCCTTTGACAATTTCTACGCCGCAATACTCGTTCTTGGAATCTATGTCCCAGGGAGTCCTCACATGTACACTTACATGCTTGGCCAGAGAAAGAGAGCTCTCTCCAAATCCAAGAGTGAATGA
Protein:  
MTLKESGHEHVYEAVEKPLQLAQTAAVLEILHGLVGLVRSPVSATLPQIGSRLYVTWGILYSFPEVRSHFLVTSLVISWSITETIRYSFFGLKEGLGSAPSWLLWLRYSSFLLLYPTGITSEVGLIYLALPHIKETEKYCIRMPNKWNFSFDNFYAAILVLGIYVPGSPHMYTYMLGQRKRALSKSKSE